Mouse Anti-stx8 Antibody (CBMOAB-07954FYB)


Cat: CBMOAB-07954FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07954FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO07954FYB 100 µg
CBMOAB-59364FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59364FYA 100 µg
MO-AB-08150H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08150C 100 µg
MO-AB-12927W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12927W 100 µg
MO-AB-21092R Monoclonal Cattle (Bos taurus) WB, ELISA MO21092R 100 µg
MO-AB-29275H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29275C 100 µg
MO-AB-65600W Monoclonal Marmoset WB, ELISA MO65600W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO07954FYB
SpecificityThis antibody binds to Zebrafish stx8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish stx8 Antibody is a mouse antibody against stx8. It can be used for stx8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesStx8 protein; Syntaxin 8; stx
UniProt IDQ7T361
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MSKDLWLENYDAACRLAQEIAENIHERNRQQRTGGNPAKINMTLRASLQKLKQNIAQLRETLNRAAVQRHIMQAEADRRQSLVDDLASRETRLNASFKGDITEAEPSRSTLMAGGNGSGSAVNPWLINESEETKGLSFGEIKNQQQQIIEAQDAGLDALASVLSRQKQMGQEIGNELDEQNEIIDDLAQLVDKTDGRIKNETKRVKLLDSKSASCGMMVVIVLLLIAIIVVACWQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry