Mouse Anti-stxbp6 Antibody (CBMOAB-07975FYB)


Cat: CBMOAB-07975FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07975FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset WB, ELISA MO07975FYB 100 µg
MO-AB-08154H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08154C 100 µg
MO-AB-21100R Monoclonal Cattle (Bos taurus) WB, ELISA MO21100R 100 µg
MO-AB-23186W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23186W 100 µg
MO-AB-29276H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29276C 100 µg
MO-AB-30525R Monoclonal Pig (Sus scrofa) WB, ELISA MO30525R 100 µg
MO-AB-65610W Monoclonal Marmoset WB, ELISA MO65610W 100 µg
MO-DKB-01312W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset
CloneMO07975FYB
SpecificityThis antibody binds to Zebrafish stxbp6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSTXBP6 binds components of the SNARE complex (see MIM 603215) and may be involved in regulating SNARE complex formation.
Product OverviewMouse Anti-Zebrafish stxbp6 Antibody is a mouse antibody against stxbp6. It can be used for stxbp6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSyntaxin binding protein 6; Amisyn; stxbp
UniProt IDQ6IQP2
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MSAKSALNKAVFLPNDERMLAAVQVKRRTKKKIPFLATGGQGEYTTFICLSVTNKKPAQVFLTKVKQFEGSSSFIRRSQWNISQLRQVNGVDAIKDCPEFDLVFDSGSDQWTAGSAGEKCVFVQILHHTCQRFIPERKVEFVNCPPKLLGGNSSLLHGAADSVSSAVQKASQALNERGERLGRAEEKTSDMMNSAQHFADTAHKLAMKHKC.
For Research Use Only | Not For Clinical Use.
Online Inquiry