Mouse Anti-Su(Fu) Antibody (CBMOAB-32240FYA)


Cat: CBMOAB-32240FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32240FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO32240FYA 100 µg
MO-NAB-00859W Monoclonal D. melanogaster (Drosophila melanogaster) IF, IHC, IP, WB NW0781 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO32240FYA
SpecificityThis antibody binds to fruit fly Su(Fu).
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe suppressor of the fusion homologue is a protein encoded by the SUFU gene in humans. In molecular biology, the protein domain inhibitor (Sufu) of the fusion protein plays an important role in cells.
Product OverviewMouse Anti-D. melanogaster Su(Fu) Antibody is a mouse antibody against Su(Fu). It can be used for Su(Fu) detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSuppressor of fused homolog; Su(fu)
UniProt IDQ9VG38
Protein RefseqThe length of the protein is 468 amino acids long.
The sequence is show below: MAEANLDKKPEVKPPPGLKAIIDHLGQVYPNQPNPLQVTTLLKYWLGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAKTEIELKQQIENPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLVAQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSVFELFPETLLNLQDDLEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDENNRQLTDTQMKREEPSFPQSMSMSSNSLHKSCPLDFQAQAPNCISLDGIEITLAPGVAKYLLLAIKDRIRHGRHFTFKAQHLALTLVAESVTGSAVTVNEPYGVLGYWIQVLIPDELVPRLMEDFRSAGLDEKCEPKERLELEWPDKNLKLIIDQPEPVLPMSLDAAPLKM.
For Research Use Only | Not For Clinical Use.
Online Inquiry