Mouse Anti-SUMO2 Antibody (CBMOAB-41933FYC)
Cat: CBMOAB-41933FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-41933FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), D. melanogaster (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Frog (Xenopus), Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO41933FC | 100 µg | ||
CBMOAB-59448FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59448FYA | 100 µg | ||
MO-AB-01481L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01481L | 100 µg | ||
MO-AB-01700R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01700R | 100 µg | ||
MO-AB-10144Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10144Y | 100 µg | ||
MO-AB-13358Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13358Y | 100 µg | ||
MO-AB-18641W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18641W | 100 µg | ||
MO-AB-21137R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21137R | 100 µg | ||
MO-AB-23770H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23770C | 100 µg | ||
MO-AB-29286H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29286C | 100 µg | ||
MO-AB-33595W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33595W | 100 µg | ||
MO-AB-33866H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33866C | 100 µg | ||
MO-AB-42660W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42660W | 100 µg | ||
MO-AB-43464W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43464W | 100 µg | ||
MO-AB-65658W | Monoclonal | Marmoset | WB, ELISA | MO65658W | 100 µg | ||
MO-NAB-00861W | Monoclonal | Chicken (Gallus gallus), D. melanogaster (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Frog (Xenopus), Zebrafish (Danio rerio) | IF, IP, WB | NW0783 | 100 µg | ||
MO-DKB-02511W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), D. melanogaster (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Frog (Xenopus), Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
Clone | MO41933FC |
Specificity | This antibody binds to Arabidopsis SUMO2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ubiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX (By similarity). |
Product Overview | Mouse Anti-Arabidopsis SUMO2 Antibody is a mouse antibody against SUMO2. It can be used for SUMO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Small ubiquitin-related modifier; SUMO; SUMO2; At5g55160 |
UniProt ID | F4K3D6 |
Protein Refseq | The length of the protein is 116 amino acids long. The sequence is show below: MSATPEEDKKPDQGAHINLKVKGQAFFVVGTWLVIDTDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLFDGRRLRAEQTPDELEMEDGDEIDAMLHQTGGGAKNGLKLFCF. |
For Research Use Only | Not For Clinical Use.
Online Inquiry