AibGenesis™ Mouse Anti-SVIP Antibody (CBMOAB-59515FYA)


Cat: CBMOAB-59515FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59515FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO59515FYA 100 µg
MO-AB-17886W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17886W 100 µg
MO-AB-29298H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29298C 100 µg
MO-AB-65697W Monoclonal Marmoset WB, ELISA MO65697W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO59515FYA
SpecificityThis antibody binds to Rhesus SVIP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SVIP Antibody is a mouse antibody against SVIP. It can be used for SVIP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSVIP
UniProt IDF7HSM3
Protein RefseqThe length of the protein is 77 amino acids long.
The sequence is show below: MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRVSIK.
For Research Use Only | Not For Clinical Use.
Online Inquiry