Mouse Anti-Swip-1 Antibody (CBMOAB-32393FYA)


Cat: CBMOAB-32393FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32393FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) WB, ELISA MO32393FYA 100 µg
MO-AB-04198Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04198Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus)
CloneMO32393FYA
SpecificityThis antibody binds to fruit fly Swip-1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Swip-1 Antibody is a mouse antibody against Swip-1. It can be used for Swip-1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSwiprosin-1, isoform B; Swip-1
UniProt IDX2J6X1
Protein RefseqThe length of the protein is 217 amino acids long.
The sequence is show below: MSVSSNASSASNKDSVDSPSSTTNTDSSELTHILNRRQEIMESQEAGIEVRRTYKVVNVYTDFPEFSRNQIKDYQKTFNTYDTARDGFLDLQELKFMMEKLGAPQTHLGLKQMIAEVDEDNDGKISFREFLLIFRKAQAGELDSDSGLNQLARLTEVDVEQVGVSGAKNFFEAKIEQQLRTNKFHDEIRAEQEERRREEEERAQRRQQFQQRAAIFQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry