Mouse Anti-syt4 Antibody (CBMOAB-08313FYB)


Cat: CBMOAB-08313FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08313FYB Monoclonal Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Pig (Sus scrofa), Zebrafish WB, ELISA MO08313FYB 100 µg
CBMOAB-32465FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO32465FYA 100 µg
CBMOAB-42060FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO42060FC 100 µg
MO-AB-08229H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08229C 100 µg
MO-AB-21205R Monoclonal Cattle (Bos taurus) WB, ELISA MO21205R 100 µg
MO-AB-30560R Monoclonal Pig (Sus scrofa) WB, ELISA MO30560R 100 µg
MO-AB-65755W Monoclonal Marmoset WB, ELISA MO65755W 100 µg
MOFY-1222-FY126 Polyclonal Zebrafish WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Pig (Sus scrofa), Zebrafish
CloneMO08313FYB
SpecificityThis antibody binds to Zebrafish syt4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish syt4 Antibody is a mouse antibody against syt4. It can be used for syt4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSynaptotagmin IV; syt
UniProt IDQ6PBU6
Protein RefseqThe length of the protein is 439 amino acids long.
The sequence is show below: MAPVTTEEAHFAEVPVSVAVVSVFGLVFSVSIFAWICCQRKANKSSNKTPPYKFVHMLKGVDIYPESLSGKKKFGGEKTPEAHGKQTLSPTGGRPDLHLDLEKRDLNGNFTTKPPTLQLKVRSSPDIDIPALQGGFANQEAGTPESVVSSHTPTPAVEKSQDKEGGLGTLFFSVEYNFEKKAFMVHIKEAHGLSPTDEQSLTSDPYIKLTLLPEKKHKVKTRVLRKTLDPAFDETFSFYGIPFARVSQLALHFMVLSFDRFSRDEVIGETLVPLADIDLSEGRVLMSRDIIKKNIRRSAGRGELLLSLCYQSTTSTLTVVVLKARHLPKADSSGPSDPYVKVNLFQGKKRVCKKKTHVKKCAPNPVFNELFVFDLPSEDGLRDTSVELLLLDSDRTSRTPVIGRLVLGTSSPGTAGEHWREICDHPRRQIAKWHALSED.
For Research Use Only | Not For Clinical Use.
Online Inquiry