Mouse Anti-syt8 Antibody (CBMOAB-08323FYB)


Cat: CBMOAB-08323FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08323FYB Monoclonal Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO08323FYB 100 µg
CBMOAB-59619FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59619FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO08323FYB
SpecificityThis antibody binds to Zebrafish syt8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish syt8 Antibody is a mouse antibody against syt8. It can be used for syt8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namessyt8
UniProt IDE7EZE8
Protein RefseqThe length of the protein is 397 amino acids long.
The sequence is show below: MTPRPSVKPTKTPHTNTTTAAPGFLPSLLDRIPLPRWAIYAIFAAIVLLILICVICCCVKCCCKGKKKRKKKPDEKINMKGISGTTTTALVQPETEDTEYSSSDQQRGKLQYSLEFNASRSELTVGIKEAAALKAMDSGGTSDPYVKVYILPNKSKTFETKVFRKTLNPVFNENFKYQIPQKELTESTLVMQVYDFNRFSKHDIIGEIRLNLSTVDWNHVIEEWRDLSEASKHEQEHLGEICFSLRYVPTSSKLTVIILEAKNLKKMDQVGSSDPYVKVQLILEKKKWKKKKTSVKKRTLNPYFNESFTFDVSFEQIQKVQLVISVWDHDKMSRNDAIGKIYLGCDATGNQLRHWADMLSNPRKPVAQWHTLLSAEQVDTTLALKHTLKIPFTNKNF.
For Research Use Only | Not For Clinical Use.
Online Inquiry