AibGenesis™ Mouse Anti-SYTL2 Antibody (CBMOAB-59626FYA)


Cat: CBMOAB-59626FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59626FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO59626FYA 100 µg
MO-AB-06391W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06391W 100 µg
MO-AB-08231H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08231C 100 µg
MO-AB-18762W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18762W 100 µg
MO-AB-21208R Monoclonal Cattle (Bos taurus) WB, ELISA MO21208R 100 µg
MO-AB-65766W Monoclonal Marmoset WB, ELISA MO65766W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO59626FYA
SpecificityThis antibody binds to Rhesus SYTL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SYTL2 Antibody is a mouse antibody against SYTL2. It can be used for SYTL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSYTL2
UniProt IDF6WZB8
Protein RefseqThe length of the protein is 365 amino acids long.
The sequence is show below: MSDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKDLAAVDVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSVWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK.
For Research Use Only | Not For Clinical Use.
Online Inquiry