AibGenesis™ Mouse Anti-Syx1A Antibody (CBMOAB-32480FYA)


Cat: CBMOAB-32480FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32480FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Mosquito WB, ELISA MO32480FYA 100 µg
MO-NAB-00672W Monoclonal D. melanogaster (Drosophila melanogaster), Mosquito IF, IHC, IP, WB NW0594 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Mosquito
CloneMO32480FYA
SpecificityThis antibody binds to fruit fly Syx1A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPlays a critical role in several secretory processes, including cuticle secretion and neurotransmitter release, and probably assists in neuronal membrane maturation or the final stages of neuronal differentiation (PubMed:7834751). Essential for embryonic viability and development (PubMed:7834751). Required for coordinated peristaltic contractions (PubMed:7834751). Recruited by Unc-13-4B to secretory lysosome-related organelles (SLs) that are essential for tracheal lumen fusion between previously separate tracheal branches (anastomosis). Possibly promotes the intracellular fusion of the extending tracheal stalk cell lumens in tracheal fusion cells (Fcs) by interacting with complementary SNAREs (such as Syb) present in the apical membrane of the FC-FC interface and the membranes of the separate tracheal stalk cells (PubMed:27323327). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Syx1A Antibody is a mouse antibody against Syx1A. It can be used for Syx1A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSyntaxin-1A; dSynt1; Syx1A; syx-1A
UniProt IDQ24547
Protein RefseqThe length of the protein is 291 amino acids long.
The sequence is show below: MTKDRLAALHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTVLGILAASYVSSYFM.
For Research Use Only | Not For Clinical Use.
Online Inquiry