Mouse Anti-szrd1 Antibody (CBMOAB-08346FYB)


Cat: CBMOAB-08346FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08346FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO08346FYB 100 µg
MO-AB-21210R Monoclonal Cattle (Bos taurus) WB, ELISA MO21210R 100 µg
MO-AB-22933W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22933W 100 µg
MO-AB-29326H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29326C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO08346FYB
SpecificityThis antibody binds to Zebrafish szrd1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish szrd1 Antibody is a mouse antibody against szrd1. It can be used for szrd1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSUZ domain-containing protein 1; szrd
UniProt IDQ504E7
Protein RefseqThe length of the protein is 161 amino acids long.
The sequence is show below: MDDEEVAESWEEAADSGEMERRLEEKLRISQKERLSSGSSSRSPMRTAIVIQDDSLPAAPPPQIRILKRPSSNGSLGSSALQTRPSPQVKSLAQREAEYAEARKRILGSATPDDTPQERPNSDRSPRGSSHTLSEENRPGNHVVRQPAGPDGTQGFHHQRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry