AibGenesis™ Mouse Anti-SZT2 Antibody (CBMOAB-59629FYA)


Cat: CBMOAB-59629FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59629FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59629FYA 100 µg
MO-AB-06396W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06396W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO59629FYA
SpecificityThis antibody binds to Rhesus SZT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SZT2 Antibody is a mouse antibody against SZT2. It can be used for SZT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein SZT2; SZT2
UniProt IDH9Z5K8
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MASERPEPEVEEAGQVFLLMKKDYRISRNVRLAWFLNHLHQTVQATSQEVLLQSEQELEVLSVLPPGWQPDEPVVPRPFLLVPSTRVTFLAWQYRFVIELDLSPSTGIVDDSTGEILFDEVFHALSRCLGGLLRPFRVPGSCIDFQPEIYITIQAYSSIIGLQSHQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry