AibGenesis™ Mouse Anti-ta1 Antibody (CBMOAB-89638FYB)


Cat: CBMOAB-89638FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89638FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays) WB, ELISA MO89638FYB 100 µg
MO-AB-00839W Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO00839W 100 µg
MO-AB-49669W Monoclonal Maize (Zea mays) WB, ELISA MO49669W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Maize (Zea mays)
CloneMO89638FYB
SpecificityThis antibody binds to Rice ta1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice ta1 Antibody is a mouse antibody against ta1. It can be used for ta1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTA1 protein; ta1
UniProt IDQ70KS8
Protein RefseqThe length of the protein is 204 amino acids long.
The sequence is show below: GKGKGKDSPMSTSAAKEDSSGKRCKSTEESNAAAEENSGKGKAAQSNSENGGGKKQGKDSSSKPPEPPKDYIHVRARRGEATDSHSLAERVRREKISQRMKLLQDLVPGCNKVVGKAVMLDEIINYVQSLQRQVEFLSMKLATVNPQLDFNNLPNLLAKDMHQSCSPLQSSHFPLETSGAPLPYINQPQQGNPLGCGLTNGMDN.
For Research Use Only | Not For Clinical Use.
Online Inquiry