Mouse Anti-taco1 Antibody (CBMOAB-08504FYB)


Cat: CBMOAB-08504FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08504FYB Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO08504FYB 100 µg
CBMOAB-11866HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO11866HB 100 µg
MO-AB-11264W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11264W 100 µg
MO-AB-65787W Monoclonal Marmoset WB, ELISA MO65787W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Marmoset
CloneMO08504FYB
SpecificityThis antibody binds to Zebrafish taco1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a mitochondrial protein that function as a translational activator of mitochondrially-encoded cytochrome c oxidase 1. Mutations in this gene are associated with Leigh syndrome.
Product OverviewMouse Anti-Zebrafish taco1 Antibody is a mouse antibody against taco1. It can be used for taco1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestaco1; TACO1 Gene(Protein Coding) Translational Activator Of Cytochrome C Oxidase I
UniProt IDF1QP29
Protein RefseqThe length of the protein is 308 amino acids long.
The sequence is show below: MILKQRQHDILTKVVCFGVKHTAHVPGERRGMLVNIMLRAFRLSRRASAVFQCPVLHPCRALHSSPVSWAGHNKWSKVKDIKIPKDAARARVIAKYTMMIRIAVREGGPNPELNVGLAQILEQCRNKNLPKTTIEGALKGAKSKPGVQYLYEATGPGGCKILIEVLTDNNMRSLNEVKRIMTKNGGALREGARRNFDRKGVVAASRDGISSEKALELAIEAGAEDVQEMEDEEDRPILQFICDMTSMKAVRSALESLGVHTLSSSLEFVSHTPSLLTQTQLETASTLLEALHDCPDVVRVWDNIHAQT.
For Research Use Only | Not For Clinical Use.
Online Inquiry