Mouse Anti-TAF7 Antibody (CBMOAB-44790FYC)


Cat: CBMOAB-44790FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44790FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Yeast, Zebrafish (Danio rerio) WB, ELISA MO44790FC 100 µg
CBMOAB-32549FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO32549FYA 100 µg
CBMOAB-08569FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO08569FYB 100 µg
CBMOAB-04380CR Monoclonal Yeast WB, ELISA MO04380CR 100 µg
MO-AB-24045W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24045W 100 µg
MO-AB-43465W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43465W 100 µg
MO-AB-46752W Monoclonal Horse (Equus caballus) WB, ELISA MO46752W 100 µg
MO-AB-65812W Monoclonal Marmoset WB, ELISA MO65812W 100 µg
MO-AB-21240R Monoclonal Cattle (Bos taurus) WB, ELISA MO21240R 100 µg
MO-AB-08250H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08250C 100 µg
MO-DKB-01430W Polyclonal Human (Homo sapiens), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Yeast, Zebrafish (Danio rerio)
CloneMO44790FC
SpecificityThis antibody binds to Arabidopsis TAF7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II.
Product OverviewMouse Anti-Arabidopsis TAF7 Antibody is a mouse antibody against TAF7. It can be used for TAF7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTATA-Box Binding Protein Associated Factor 7; TAF7 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 55kDa; TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase II, F, 55kD; RNA Polymerase II TBP-Associated Factor Subunit F; TAF(II)55; TAFII-55; TAFII55
UniProt IDB9DG24
Protein RefseqThe length of the protein is 239 amino acids long. The sequence is show below: MEEQFILRVPPSVSERIDRLLSEDASTSDEIPLDLFFSEDGRNGTFMIGNDEFPASLLDLPAVVESFKTYDDCALVKTADIGQMIMVREPGDPAPNTVEYRHGLTPPMKDARKRRFRREPDLNPELVQRVERDLLNILSGGTVENVSFSFYFRHMMCLYLLLGFSNFIYLNFFWCRYMSKRNQLRTRMLVMQVRKYLLLHLHLLKSLKLLRQALVIQQELNRREVNQKILMIQCEFIII.
See other products for " TAF7 "
For Research Use Only | Not For Clinical Use.
Online Inquiry