Mouse Anti-TAF7 Antibody (CBMOAB-44790FYC)
Cat: CBMOAB-44790FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-44790FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Yeast, Zebrafish (Danio rerio) | WB, ELISA | MO44790FC | 100 µg | ||
CBMOAB-32549FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO32549FYA | 100 µg | ||
CBMOAB-08569FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO08569FYB | 100 µg | ||
CBMOAB-04380CR | Monoclonal | Yeast | WB, ELISA | MO04380CR | 100 µg | ||
MO-AB-24045W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24045W | 100 µg | ||
MO-AB-43465W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43465W | 100 µg | ||
MO-AB-46752W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46752W | 100 µg | ||
MO-AB-65812W | Monoclonal | Marmoset | WB, ELISA | MO65812W | 100 µg | ||
MO-AB-21240R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21240R | 100 µg | ||
MO-AB-08250H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08250C | 100 µg | ||
MO-DKB-01430W | Polyclonal | Human (Homo sapiens), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Yeast, Zebrafish (Danio rerio) |
Clone | MO44790FC |
Specificity | This antibody binds to Arabidopsis TAF7. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. |
Product Overview | Mouse Anti-Arabidopsis TAF7 Antibody is a mouse antibody against TAF7. It can be used for TAF7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | TATA-Box Binding Protein Associated Factor 7; TAF7 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 55kDa; TATA Box Binding Protein (TBP)-Associated Factor, RNA Polymerase II, F, 55kD; RNA Polymerase II TBP-Associated Factor Subunit F; TAF(II)55; TAFII-55; TAFII55 |
UniProt ID | B9DG24 |
Protein Refseq | The length of the protein is 239 amino acids long. The sequence is show below: MEEQFILRVPPSVSERIDRLLSEDASTSDEIPLDLFFSEDGRNGTFMIGNDEFPASLLDLPAVVESFKTYDDCALVKTADIGQMIMVREPGDPAPNTVEYRHGLTPPMKDARKRRFRREPDLNPELVQRVERDLLNILSGGTVENVSFSFYFRHMMCLYLLLGFSNFIYLNFFWCRYMSKRNQLRTRMLVMQVRKYLLLHLHLLKSLKLLRQALVIQQELNRREVNQKILMIQCEFIII. |
See other products for " TAF7 "
MO-AB-13379Y | Mouse Anti-TAF7 Antibody (MO-AB-13379Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry