Mouse Anti-TAF9 Antibody (CBMOAB-44792FYC)
Cat: CBMOAB-44792FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-44792FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) | WB, ELISA | MO44792FC | 100 µg | ||
CBMOAB-59699FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59699FYA | 100 µg | ||
CBMOAB-08574FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO08574FYB | 100 µg | ||
CBMOAB-04382CR | Monoclonal | Yeast | WB, ELISA | MO04382CR | 100 µg | ||
CBMOAB-11888HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO11888HB | 100 µg | ||
MO-AB-06412W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO06412W | 100 µg | ||
MO-AB-16799W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16799W | 100 µg | ||
MO-AB-65815W | Monoclonal | Marmoset | WB, ELISA | MO65815W | 100 µg | ||
MO-AB-21242R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21242R | 100 µg | ||
MO-AB-29340H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29340C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) |
Clone | MO44792FC |
Specificity | This antibody binds to Arabidopsis TAF9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds to the basal transcription factor GTF2B as well as to several transcriptional activators such as p53 and VP16. In human, TAF9 and AK6 (GeneID: 102157402) are two distinct genes that share 5' exons. A similar but distinct gene (TAF9L) has been found on the X chromosome and a pseudogene has been identified on chromosome 19. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Arabidopsis TAF9 Antibody is a mouse antibody against TAF9. It can be used for TAF9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | TATA-Box Binding Protein Associated Factor 9; TAF9 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 32kDa; Transcription Initiation Factor TFIID 31 KDa Subunit; Transcription Initiation Factor TFIID 32 KDa Subunit; RNA Polymerase II TBP-Associated Factor Subunit G; STAF31/32; TAFII-31; TAFII-32; TAFII31 |
UniProt ID | Q9SYH2 |
Protein Refseq | The length of the protein is 183 amino acids long. The sequence is show below: MAGEGEEDVPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVEVLTDAQVYSEHASKPNIDCDDVKLAIQSKVNFSFSQPPPREVLLELAASRNKIPLPKSIAGPGVPLPPEQDTLLSPNYQLVIPKKSVSTEPEETEDDEEMTDPGQSSQEQQQQQQQTSDLPSQTPQRVSFPLSRRPK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry