Mouse Anti-TAF9 Antibody (CBMOAB-44792FYC)


Cat: CBMOAB-44792FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44792FYC Monoclonal A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) WB, ELISA MO44792FC 100 µg
CBMOAB-59699FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59699FYA 100 µg
CBMOAB-08574FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO08574FYB 100 µg
CBMOAB-04382CR Monoclonal Yeast WB, ELISA MO04382CR 100 µg
CBMOAB-11888HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO11888HB 100 µg
MO-AB-06412W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06412W 100 µg
MO-AB-16799W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16799W 100 µg
MO-AB-65815W Monoclonal Marmoset WB, ELISA MO65815W 100 µg
MO-AB-21242R Monoclonal Cattle (Bos taurus) WB, ELISA MO21242R 100 µg
MO-AB-29340H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29340C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio)
CloneMO44792FC
SpecificityThis antibody binds to Arabidopsis TAF9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInitiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the smaller subunits of TFIID that binds to the basal transcription factor GTF2B as well as to several transcriptional activators such as p53 and VP16. In human, TAF9 and AK6 (GeneID: 102157402) are two distinct genes that share 5' exons. A similar but distinct gene (TAF9L) has been found on the X chromosome and a pseudogene has been identified on chromosome 19. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Arabidopsis TAF9 Antibody is a mouse antibody against TAF9. It can be used for TAF9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTATA-Box Binding Protein Associated Factor 9; TAF9 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 32kDa; Transcription Initiation Factor TFIID 31 KDa Subunit; Transcription Initiation Factor TFIID 32 KDa Subunit; RNA Polymerase II TBP-Associated Factor Subunit G; STAF31/32; TAFII-31; TAFII-32; TAFII31
UniProt IDQ9SYH2
Protein RefseqThe length of the protein is 183 amino acids long. The sequence is show below: MAGEGEEDVPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVEVLTDAQVYSEHASKPNIDCDDVKLAIQSKVNFSFSQPPPREVLLELAASRNKIPLPKSIAGPGVPLPPEQDTLLSPNYQLVIPKKSVSTEPEETEDDEEMTDPGQSSQEQQQQQQQTSDLPSQTPQRVSFPLSRRPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry