Mouse Anti-tagln2 Antibody (CBMOAB-08582FYB)
Cat: CBMOAB-08582FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-08582FYB | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO08582FYB | 100 µg | ||
MO-AB-01491L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01491L | 100 µg | ||
MO-AB-08012W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08012W | 100 µg | ||
MO-AB-08253H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08253C | 100 µg | ||
MO-AB-10162Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10162Y | 100 µg | ||
MO-AB-12882W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12882W | 100 µg | ||
MO-AB-17849Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17849Y | 100 µg | ||
MO-AB-21248R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21248R | 100 µg | ||
MO-AB-29348H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29348C | 100 µg | ||
MO-AB-30568R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30568R | 100 µg | ||
MO-AB-33612W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33612W | 100 µg | ||
MO-AB-42673W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42673W | 100 µg | ||
MO-AB-46753W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46753W | 100 µg | ||
MO-AB-65818W | Monoclonal | Marmoset | WB, ELISA | MO65818W | 100 µg | ||
MO-DKB-00775W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
Clone | MO08582FYB |
Specificity | This antibody binds to Zebrafish tagln2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytoskeleton |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-Zebrafish tagln2 Antibody is a mouse antibody against tagln2. It can be used for tagln2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Transgelin; tagln |
UniProt ID | Q803W9 |
Protein Refseq | The length of the protein is 201 amino acids long. The sequence is show below: MANKGPSYGLSREVQSKIDKKYDPELEGRLVQWIVSQCGEAIGKPQPGKQGFQQWLKDGCILCELINSLFKDSKPVKKIQSSSMAFKQMEQISQFLTAAERYGITKSDIFQTVDLWEGKDLAAVQMTLLSLGSLAVTKDDGCYRGDPAWFPKKSQENRREFSEEQMKEGQSVIGLQMGTNKGASQAGMTGYGRPRQILNNQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry