Mouse Anti-TAGLN3 Antibody (MO-AB-01492L)
Cat: MO-AB-01492L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-01492L | Monoclonal | Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO01492L | 100 µg | ||
MO-AB-01720R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01720R | 100 µg | ||
MO-AB-04210Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04210Y | 100 µg | ||
MO-AB-06928Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06928Y | 100 µg | ||
MO-AB-07455W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07455W | 100 µg | ||
MO-AB-12883W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12883W | 100 µg | ||
MO-AB-17850Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17850Y | 100 µg | ||
MO-AB-21249R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21249R | 100 µg | ||
MO-AB-29349H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29349C | 100 µg | ||
MO-AB-33613W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33613W | 100 µg | ||
MO-AB-33875H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33875C | 100 µg | ||
MO-AB-35796W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35796W | 100 µg | ||
MO-AB-46754W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46754W | 100 µg | ||
MO-AB-65819W | Monoclonal | Marmoset | WB, ELISA | MO65819W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO01492L |
Specificity | This antibody binds to Elephant TAGLN3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | TAGLN2P3 (Transgelin 2 Pseudogene 2) is a Pseudogene, and is affiliated with the lncRNA class. |
Product Overview | This product is a mouse antibody against TAGLN3. It can be used for TAGLN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Transgelin 3; Neuronal Protein NP25; Neuronal Protein 22; NP22; NP25; Transgelin-3; NP24 |
UniProt ID | G3T6G1 |
Protein Refseq | The length of the protein is 199 amino acids long. The sequence is show below: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRGHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry