Mouse Anti-TAS2R46 Antibody (MO-AB-06425W)


Cat: MO-AB-06425W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06425W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO06425W 100 µg
MO-AB-18934W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18934W 100 µg
MO-AB-21279R Monoclonal Cattle (Bos taurus) WB, ELISA MO21279R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO06425W
SpecificityThis antibody binds to Rhesus TAS2R46.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TAS2R46 Antibody is a mouse antibody against TAS2R46. It can be used for TAS2R46 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTaste receptor type 2; TAS2R46
UniProt IDF6Y4U3
Protein RefseqThe length of the protein is 286 amino acids long.
The sequence is show below: FSILIVVIFVIGNFANGFIALINSTEWWVKRQKISFADQILAALAVFRVGLLWVLLLHWCATEFNLAFYSVEVRSTAYNVWVVTNHFSNWLGTSLSMFYLLKIATFSNLIFLHLKRRVMNVILVMLLGSLLFLACHLFVINMNQIVQTKEYEGNMTWKVKLRSAIYFSNMTVTMLANFVPLTLTLISFLLLICSLCKHLKKMQVHGKGSQDPSTKVHIKALQTVTSFLLLCAIHFLAIMLSVWNFERLENKPVIMFCQATVFSYPSTHPFILIWGNKKLKQIFLST.
For Research Use Only | Not For Clinical Use.
Online Inquiry