AibGenesis™ Mouse Anti-TCEAL4 Antibody (CBMOAB-59886FYA)


Cat: CBMOAB-59886FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59886FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO59886FYA 100 µg
MO-AB-16180W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16180W 100 µg
MO-AB-21349R Monoclonal Cattle (Bos taurus) WB, ELISA MO21349R 100 µg
MO-AB-65968W Monoclonal Marmoset WB, ELISA MO65968W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO59886FYA
SpecificityThis antibody binds to Rhesus TCEAL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. This family is comprised of nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located on the X chromosome. Alternatively splicing results in multiple transcript variants. There is a pseudogene for this gene on chromosome 13. (From NCBI)
Product OverviewMouse Anti-Rhesus TCEAL4 Antibody is a mouse antibody against TCEAL4. It can be used for TCEAL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription elongation factor A protein-like 4; TCEAL4
UniProt IDI2CTC2
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MEKLYNENEGMASNQGKMKNEEQPQDERKPEVACTLEDKKLENEGKTENKGKTGDEEMLKDKGKPESEGKAKEEGKSEREGESEMEGGSEREGKPGIEGKPESQGEPGSETRAAGKRPAEDDIPRKAKRKTNKGLAHYLKEYKEAIHDMNFSNEDMIREFDNMAKVQDEKRKSKQKLGAFLWMQRNLQDPFYPRGPREFRGGCRAPRRDIEDIPYV.
For Research Use Only | Not For Clinical Use.
Online Inquiry