Mouse Anti-tcf15 Antibody (CBMOAB-08881FYB)


Cat: CBMOAB-08881FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08881FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO08881FYB 100 µg
CBMOAB-59898FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59898FYA 100 µg
MO-AB-04312Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04312Y 100 µg
MO-AB-08316H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08316C 100 µg
MO-AB-21357R Monoclonal Cattle (Bos taurus) WB, ELISA MO21357R 100 µg
MO-AB-29371H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29371C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO08881FYB
SpecificityThis antibody binds to Zebrafish tcf15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is found in the nucleus and may be involved in the early transcriptional regulation of patterning of the mesoderm. The encoded basic helix-loop-helix protein requires dimerization with another basic helix-loop-helix protein for efficient DNA binding. (From NCBI)
Product OverviewMouse Anti-Zebrafish tcf15 Antibody is a mouse antibody against tcf15. It can be used for tcf15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesParaxis; tcf15; par
UniProt IDQ9YHA3
Protein RefseqThe length of the protein is 183 amino acids long.
The sequence is show below: MAFAMLRPIATHLAYPDVSMMSEDEENRSESDGSSEQSYGCCPSAEKRRRMSRKTTVGSVVIVKQRNAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLIGDGGEDAHPCVSAVYSAQGDSGGKQPRTICIFCFSTQRKGIKDLTDCVRMRGIASLRMFSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry