Mouse Anti-tctn1 Antibody (CBMOAB-08960FYB)


Cat: CBMOAB-08960FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08960FYB Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO08960FYB 100 µg
Inquiry
CBMOAB-12138HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO12138HB 100 µg
Inquiry
MO-AB-06479W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06479W 100 µg
Inquiry
MO-AB-21394R Monoclonal Cattle (Bos taurus) WB, ELISA MO21394R 100 µg
Inquiry
MO-AB-22828W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22828W 100 µg
Inquiry
MO-AB-66013W Monoclonal Marmoset WB, ELISA MO66013W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO08960FYB
SpecificityThis antibody binds to Zebrafish tctn1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of secreted and transmembrane proteins. The orthologous gene in mouse functions downstream of smoothened and rab23 to modulate hedgehog signal transduction. This protein is a component of the tectonic-like complex, which forms a barrier between the ciliary axoneme and the basal body. A mutation in this gene was found in a family with Joubert syndrome-13. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish tctn1 Antibody is a mouse antibody against tctn1. It can be used for tctn1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestctn1; si:ch211-193e13.1; TCTN1 Gene(Protein Coding) Tectonic Family Member 1
UniProt IDF1R392
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: FFTFPASAGTAHCLDSNPAGFLKEQTSRCMRSFDLARDCTTLGTLSLGNYLNFSIRSMVCSLRKVIGVEVAAITLQSLEGTQMPVDPADSSSYFPMLLQSGDVCSNVVQQVKYTFVYNKAGEILNVMAAFLLGAIKNVMVPIQQEFQIMFLQENSQTTGLKYSGNPGYVLGRPLVAGTIQHPKCGIVQFADPKGSLTTIQTSVDQDCLRGSSRRSPVLFGINTISGCTLKLSDGVNCSQVSEVILWALKGQSFPDHVASFGNSLPQNSLDWVPIQNQTISLFTKGAQACSIPLSYHLEVKWTKYGALLNPQAQIVSIMETIITNTSSLAFITSPGGLLPVTSSVSFVDVSASATPGFKVPPTIDAKLPFDFFFPFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry