AibGenesis™ Mouse Anti-TEX22 Antibody (MO-AB-15386W)


Cat: MO-AB-15386W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15386W Monoclonal Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO15386W 100 µg
MO-AB-29408H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29408C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO15386W
SpecificityThis antibody binds to Chimpanzee TEX22.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee TEX22 Antibody is a mouse antibody against TEX22. It can be used for TEX22 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTestis expressed gene 22; TEX22
UniProt IDK7BC38
Protein RefseqThe length of the protein is 150 amino acids long.
The sequence is show below: MDSRKLSPQGKKLESHLSQEHRRPPLGLTAAWGQPSIQSSVQQGLQTQDWVCEPPERGRPGRQWSVSIDERRRLATLGGRERPGAAGTQLHCRDVVQMVAQLVSEDVDKDVLLPHPLRSTESTNAFQDFLARSAPFWHNATFEASRSPPS.
For Research Use Only | Not For Clinical Use.
Online Inquiry