AibGenesis™ Mouse Anti-tex261 Antibody (CBMOAB-09143FYB)


Cat: CBMOAB-09143FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09143FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09143FYB 100 µg
MO-AB-08365H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08365C 100 µg
MO-AB-21445R Monoclonal Cattle (Bos taurus) WB, ELISA MO21445R 100 µg
MO-AB-26484W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26484W 100 µg
MO-AB-29409H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29409C 100 µg
MO-AB-66065W Monoclonal Marmoset WB, ELISA MO66065W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO09143FYB
SpecificityThis antibody binds to Zebrafish tex261.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tex261 Antibody is a mouse antibody against tex261. It can be used for tex261 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:110022; tex261; zgc:11002
UniProt IDQ503X9
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MWFIYLLSWLSLVVQICFVTLAIAAGLYYLAELIEEYTVATSRIIKYMIMFSTAVLVGLYLFEGFPTLMVGVGLFTNLVYFGLLQTFPYIMLTSPNFILSCVLVVLNHYMAFQYFAEEYYPFSEVLAYFTICLWVIPFSFFVSLSAGENVLPSTMQQGDDVVSNYFTKGKRGKRSGILLVFSFLKEAVVPSRQKMY.
For Research Use Only | Not For Clinical Use.
Online Inquiry