Mouse Anti-tfap2a Antibody (CBMOAB-09173FYB)


Cat: CBMOAB-09173FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09173FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish WB, ELISA MO09173FYB 100 µg
CBMOAB-60076FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60076FYA 100 µg
MO-AB-08367H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08367C 100 µg
MO-AB-17885Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17885Y 100 µg
MO-AB-21461R Monoclonal Cattle (Bos taurus) WB, ELISA MO21461R 100 µg
MO-AB-30627R Monoclonal Pig (Sus scrofa) WB, ELISA MO30627R 100 µg
MO-AB-66071W Monoclonal Marmoset WB, ELISA MO66071W 100 µg
MO-DKB-03920W Polyclonal Zebrafish (Danio rerio) Pep-ELISA 100 µg
MOFY-1222-FY16 Polyclonal Zebrafish WB, IHC, ICC, IF, ELISA 100 µg
MO-MMB-0598 Polyclonal Zebrafish (Danio rerio) IA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish
CloneMO09173FYB
SpecificityThis antibody binds to Zebrafish tfap2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a transcription factor that binds the consensus sequence 5'-GCCNNNGGC-3'. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Zebrafish tfap2a Antibody is a mouse antibody against tfap2a. It can be used for tfap2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription factor AP2 alpha 2; tfap2
UniProt IDQ8UVE5
Protein RefseqThe length of the protein is 437 amino acids long.
The sequence is show below: MYHIQKEETRMSLMGKMGDWQDRHDGTSNGTARLPQLGSVGQSPYTSAPPLSHTPNSDFQPPYFPPPYQPIYPQSQDPYSHVNDPYSINSLHAQSQPQHPGWPGQRQSQESSLLHQHRGLPHQLCREYRREVLLPSGHGIDTGLTDSIPIHGIPHSLEDVQQVEDQGIHIPDQTVIKKGPVSISKNNSNISAIPINKDGLVGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAIAEYMNRQHSDPNEQVQRKNMLLATKQICKEFTDLLSQDRSPLGNSRPQPILEPGIQSCLTHFSLISHGFGTPAVCAALTALQNYLTEAIKAMDKMYLNNNPNSHSETGSKAGDKDEKHRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry