AibGenesis™ Mouse Anti-thap4 Antibody (CBMOAB-09310FYB)


Cat: CBMOAB-09310FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09310FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO09310FYB 100 µg
MO-AB-21521R Monoclonal Cattle (Bos taurus) WB, ELISA MO21521R 100 µg
MO-AB-26068W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26068W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO09310FYB
SpecificityThis antibody binds to Zebrafish thap4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish thap4 Antibody is a mouse antibody against thap4. It can be used for thap4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:ch211-105d4.5; thap4; si:ch211-105d4.5; NP_001122208.
UniProt IDB0S7M2
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MSCPFNYSADLNPAVLPLDWLLGTWQSDEPGEGSFPSIAPFRYTETLHFSHVGQPVVNFMFNAFHAESKKPLHRECGFIRLQPGTNRVAFIIAQNSGLVEIEEGELTGQQLTLQSTALARTSFAKQPHVQQISRHIQLRADGRLEQTVCMALEGQPLTQHLHITYRRTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry