Mouse Anti-theg Antibody (CBMOAB-09329FYB)


Cat: CBMOAB-09329FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09329FYB Monoclonal Zebrafish (Danio rerio), Fruit fly (Drosophila melanogaster), Rhesus (Macaca mulatta) WB, ELISA MO09329FYB 100 µg
CBMOAB-60164FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60164FYA 100 µg
MO-AB-03225W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO03225W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Fruit fly (Drosophila melanogaster), Rhesus (Macaca mulatta)
CloneMO09329FYB
SpecificityThis antibody binds to Zebrafish theg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish theg Antibody is a mouse antibody against theg. It can be used for theg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestheg; si:ch211-137c4.4; THEG Gene(Protein Coding) Theg Spermatid Protein
UniProt IDA8WHR5
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MASRIDQLAKPKTNLLKFPDRRSVYWLDELPSRPKSSTTAFETTPRLEKLVQSKRPIHFYEDNRRSVEWVVSAAALKACPSQRVCSLALPRPPADGWQPDRPLMDTLSVAVKTAKPSPRICYLAQPKQIKMTLTHFSVESSEHEIGISTTPSARLLRLASPKQVHPQHTLARSVSWPIPKHVLKAGASERLQVLARPKTRQALFEGYNPYRVSPAAGSATASPRLLELSLPLPRKCREQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry