Mouse Anti-Tim14 Antibody (CBMOAB-32996FYA)


Cat: CBMOAB-32996FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32996FYA Monoclonal Fruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO32996FYA 100 µg
MO-AB-03228W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO03228W 100 µg
MO-AB-13448Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO13448Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss)
CloneMO32996FYA
SpecificityThis antibody binds to fruit fly Tim14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity (By similarity).
Product OverviewMouse Anti-D. melanogaster Tim14 Antibody is a mouse antibody against Tim14. It can be used for Tim14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial import inner membrane translocase subunit TIM14; Tim14
UniProt IDQ9VTJ8
Protein RefseqThe length of the protein is 118 amino acids long.
The sequence is show below: MASSVILAGLSVAAVGFAGKHLMRRMPQMTTKFNEALKNLPKYDAESMAASKYYKGGFDPKMNKREASLILGVSPSASKIKIKDAHKKIMLLNHPDRGGSPYLAAKINEAKDFLDKAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry