Mouse Anti-timm10 Antibody (CBMOAB-09426FYB)
Cat: CBMOAB-09426FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-09426FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO09426FYB | 100 µg | ||
| MO-AB-15149W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15149W | 100 µg | ||
| MO-AB-21580R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21580R | 100 µg | ||
| MO-AB-29458H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29458C | 100 µg | ||
| MO-AB-66195W | Monoclonal | Marmoset | WB, ELISA | MO66195W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO09426FYB |
| Specificity | This antibody binds to Zebrafish timm10. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish timm10 Antibody is a mouse antibody against timm10. It can be used for timm10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Mitochondrial import inner membrane translocase subunit Tim10; timm10; tim1 |
| UniProt ID | Q6DI06 |
| Protein Refseq | The length of the protein is 88 amino acids long. The sequence is show below: MDPMKAQQLAAELEVEMMADMYNRMTNACHRKCVPPHYKEAELSKGEAVCLDRCVAKYLDLHERLGRKLTELSVQDEEVMRKAAAGTG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry