AibGenesis™ Mouse Anti-timm23 Antibody (CBMOAB-09435FYB)


Cat: CBMOAB-09435FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09435FYB Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09435FYB 100 µg
CBMOAB-12193HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO12193HB 100 µg
MO-AB-06534W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06534W 100 µg
MO-AB-16029W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16029W 100 µg
MO-AB-21589R Monoclonal Cattle (Bos taurus) WB, ELISA MO21589R 100 µg
MO-AB-29466H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29466C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09435FYB
SpecificityThis antibody binds to Zebrafish timm23.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is part of a complex located in the inner mitochondrial membrane that mediates the transport of transit peptide-containing proteins across the membrane. Multiple transcript variants, one protein-coding and others not protein-coding, have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish timm23 Antibody is a mouse antibody against timm23. It can be used for timm23 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial import inner membrane translocase subunit Tim23; timm2
UniProt IDQ7T2P6
Protein RefseqThe length of the protein is 208 amino acids long.
The sequence is show below: MDNSTPPPGGFKGGLGSIFGGGTPEYSNTELSGVPLTGMSPLSPYLNVDPRYLIQDTDEFILPTGANKTRGRFELAFFTIGGCCITGAAFGTLNGLRMGLSETRDMPWSKPRNVQILNMVTRQGASWANTLGSVALLYSVFGVAIEKARGAEDDLNTVAAGTLTGMVFKSTGGLKGVARGGLIGLAMSGLYALYNNWDHLKGKSPSHY.
For Research Use Only | Not For Clinical Use.
Online Inquiry