AibGenesis™ Mouse Anti-timp2a Antibody (CBMOAB-09449FYB)


Cat: CBMOAB-09449FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09449FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO09449FYB 100 µg
Inquiry
MO-DKB-03928W Polyclonal Zebrafish (Danio rerio) Pep-ELISA 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO09449FYB
SpecificityThis antibody binds to Zebrafish timp2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. (From NCBI)
Product OverviewMouse Anti-Zebrafish timp2a Antibody is a mouse antibody against timp2a. It can be used for timp2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTissue inhibitor of metalloproteinase 2; timp2a; timp
UniProt IDQ7SZM6
Protein RefseqThe length of the protein is 220 amino acids long.
The sequence is show below: MKSVRSCIGTLVVLVLFRVGEIAEACSCSPVHPQQAFCNADVVIRAKVVGKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDRHIDVVFTAPSSAVCGVTNLDTNGKKEYLISGKAEANGKMHVTLCDLIMPWESMSATQKKSLSQRYQMGCDCKITRCATFPCEISAPEECLWTDWVTEKIIHGRQSDHYACIKRGDGSCAWYRGVAPPKKEFLEVEDP.
For Research Use Only | Not For Clinical Use.
Online Inquiry