AibGenesis™ Mouse Anti-Tkv Antibody (CBMOAB-33053FYA)


Cat: CBMOAB-33053FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-33053FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO33053FYA 100 µg
MO-DKB-03082W Polyclonal Fruit fly (Drosophila melanogaster) ELISA, IP, WB 100 µg
MO-DKB-03083W Polyclonal Fruit fly (Drosophila melanogaster) ELISA, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO33053FYA
SpecificityThis antibody binds to fruit fly Tkv.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations; Plasma Membrane; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Tkv Antibody is a mouse antibody against Tkv. It can be used for Tkv detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG14026-PC, isoform C; FI19333p1; tkv; tkv-RC
UniProt IDQ9VMT1
Protein RefseqThe length of the protein is 575 amino acids long.
The sequence is show below: MRLQLVALELQATSGTADGLFEEIALEALTRSEFSANVQPDVEAMAAAALSGMEMGSGPGSEGYEDADNEKSKTVENARSLTCYCDGSCPDNVSNGTCETRPGGSCFSAVQQLYDETTGMYEEERTYGCMPPEDNGGFLMCKVAAVPHLHGKNIVCCDKEDFCNRDLYPTYTPKLTTPAPDLPVSSESLHTLAVFGSIIISLSVFMLIVASLCFTYKRREKLRKQPRLINSMCNSQLSPLSQLVEQSSGSGSGLPLLVQRTIAKQIQMVRLVGKGRYGEVWLAKWRDERVAVKTFFTTEEASWFRETEIYQTVLMRHDNILGFIAADIKGNGSWTQMLLITDYHEMGSLHDYLSMSVINPQKLQLLAFSLASGLAHLHDEIFGTPGKPAIAHRDIKSKNILVKRNGQCAIADFGLAVKYNSELDVIHIAQNPRVGTRRYMAPEVLSQQLDPKQFEEFKRADMYSVGLVLWEMTRRCYTPVSGTKTTTCEDYALPYHDVVPSDPTFEDMHAVVCVKGFRPPIPSRWQEDDVLATVSKIMQECWHPNPTVRLTALRVKKTLGRLETDCLIDVPIKIV.
For Research Use Only | Not For Clinical Use.
Online Inquiry