Mouse Anti-tle5 Antibody (MO-AB-08453H)


Cat: MO-AB-08453H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08453H Monoclonal Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO08453C 100 µg
MO-AB-29483H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29483C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO08453C
SpecificityThis antibody binds to Frog tle5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against tle5. It can be used for tle5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAes protein; aes
UniProt IDQ6P9I8
Protein RefseqThe length of the protein is 197 amino acids long.
The sequence is show below: MMFPQSSSRHSGSSHMPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLAGEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLHGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQLQVHQLSQLQALALPLTSLPMGLQAPSLPISASSGLLSLSALGSQGHLPKEDKNGHDGDPRPDDDGDKSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry