Mouse Anti-TM4SF19 Antibody (CBMOAB-60344FYA)


Cat: CBMOAB-60344FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60344FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO60344FYA 100 µg
MO-AB-06562W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06562W 100 µg
MO-AB-29494H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29494C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO60344FYA
SpecificityThis antibody binds to Rhesus TM4SF19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain tissue, this gene is expressed at high levels in the parietal lobe, occipital lobe, hippocampus, pons, white matter, corpus callosum, and cerebellum. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus TM4SF19 Antibody is a mouse antibody against TM4SF19. It can be used for TM4SF19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTM4SF19
UniProt IDF7HSB8
Protein RefseqThe length of the protein is 209 amino acids long.
The sequence is show below: MLSSPCTPASSRTCSRILGLSLGTAALFAAGANMALLFPNWDVTYLLRGLIGKHAMLGTGLWGGGLMVLTAAILISLKGWRYGCFSKSGLCRSVLTALLSSGLALLGALICFVTSGAALKDGPFCMFDTSSFNQTQAWKYGYPFKDLHSRNYLYDRLLWNSVCLEPSTAVVWHVSLFSALLCISLLQLLLVVAHVINSLLGLFCSLCEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry