Mouse Anti-tmem11 Antibody (CBMOAB-09713FYB)


Cat: CBMOAB-09713FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09713FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09713FYB 100 µg
CBMOAB-60413FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60413FYA 100 µg
MO-AB-11266W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11266W 100 µg
MO-AB-21761R Monoclonal Cattle (Bos taurus) WB, ELISA MO21761R 100 µg
MO-AB-29520H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29520C 100 µg
MO-AB-66344W Monoclonal Marmoset WB, ELISA MO66344W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09713FYB
SpecificityThis antibody binds to Zebrafish tmem11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTMEM111 (Transmembrane Protein 115) is a Protein Coding gene. Among its related pathways are Transport to the Golgi and subsequent modification and Metabolism of proteins. Gene Ontology (GO) annotations related to this gene include identical protein binding.
Product OverviewMouse Anti-Zebrafish tmem11 Antibody is a mouse antibody against tmem11. It can be used for tmem11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 11, mitochondrial; tmem1
UniProt IDQ6NWH5
Protein RefseqThe length of the protein is 187 amino acids long.
The sequence is show below: MASLGRRRGVPVNRERGVMAATECYIVHEIYNGENAQEQFEYELEQALEAQYRYIVIEPTRIGDETARWVAVGNCLHKTAVLAGAACLLTPLALPVEYSRYVALPAGALSLACATLYGISWQFDPCCKYQVEYDSQKLSRLPLHTLTSSTPVVLVRRDDVHRKRLHNTIALAALAYCAKKIYELYAV.
For Research Use Only | Not For Clinical Use.
Online Inquiry