AibGenesis™ Mouse Anti-tmem120b Antibody (CBMOAB-09731FYB)


Cat: CBMOAB-09731FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09731FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO09731FYB 100 µg
CBMOAB-60418FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60418FYA 100 µg
MO-AB-21769R Monoclonal Cattle (Bos taurus) WB, ELISA MO21769R 100 µg
MO-AB-23811W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23811W 100 µg
MO-AB-66356W Monoclonal Marmoset WB, ELISA MO66356W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO09731FYB
SpecificityThis antibody binds to Zebrafish tmem120b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionNecessary for efficient adipogenesis. Does not show ion channel activity. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish tmem120b Antibody is a mouse antibody against tmem120b. It can be used for tmem120b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 120B; tmem120
UniProt IDQ1LY80
Protein RefseqThe length of the protein is 337 amino acids long.
The sequence is show below: MSLERCQSEWTEIEQEYQQLQETHKVYRQKLEELTNLQAICSSAISKQRKGLKDLKQSLYKCKKSCNGKDSEVINDLQVQIKERQNVFFDMEAYLPKRNGLYLNLVLGNVNVTLLSNQAKFAYKDEYEKFKLYMTIILMFGAVTCLFLLNYRVTDEIFNFLLVWYYCTLTIRESILRSNGSRIKGWWVSHHYVSTFLSGVMLTWPEGPMYQMFRSQFLAFSIYQSCVQFLQYYYQSGCLYRLRALGERNQLDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLYNAVTLFRLSALDDCKEWQVFMLALTFLVLFLGNFLTTLKVVHQKLLKNKDKVKNN.
For Research Use Only | Not For Clinical Use.
Online Inquiry