Mouse Anti-tmem123 Antibody (CBMOAB-08058FYB)


Cat: CBMOAB-08058FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08058FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Primat-Orangutan, Rhesus (Macaca mulatta) WB, ELISA MO08058FYB 100 µg
CBMOAB-60423FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60423FYA 100 µg
MO-AB-17903W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17903W 100 µg
MO-AB-29523H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29523C 100 µg
MO-AB-66358W Monoclonal Marmoset WB, ELISA MO66358W 100 µg
MO-DKB-01041W Polyclonal Rat (Rattus norvegicus), Primat-Orangutan, Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Primat-Orangutan, Rhesus (Macaca mulatta)
CloneMO08058FYB
SpecificityThis antibody binds to Zebrafish tmem123.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a highly glycosylated transmembrane protein with a high content of threonine and serine residues in its extracellular domain, similar to a broadly defined category of proteins termed mucins. Exposure of some cell types to anti-PORIMIN (pro-oncosis receptor inducing membrane injury) antibody, crosslinks this protein on the cell surface and induces a type of cell death termed oncosis. Oncosis is distinct from apoptosis and is characterized by a loss of cell membrane integrity without DNA fragmentation. This gene product is proposed to function as a cell surface receptor that mediates cell death.
Product OverviewMouse Anti-Zebrafish tmem123 Antibody is a mouse antibody against tmem123. It can be used for tmem123 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem123; TMEM123 Gene(Protein Coding) Transmembrane Protein 123
UniProt IDF1QJC5
Protein RefseqThe length of the protein is 287 amino acids long.
The sequence is show below: MNLCLWLNLITFSGLLLSLDTRAHQAEEEPLTASNMSHYSTHLSKAKSITPTEASVNTLHISTPSKHLISASIGVPPGHLTAGGGFDAGSFLGGMILAFIIILAVAVGYRLFCSKRAIRYRVIEEHDAII.
For Research Use Only | Not For Clinical Use.
Online Inquiry