AibGenesis™ Mouse Anti-tmem126a Antibody (CBMOAB-09735FYB)


Cat: CBMOAB-09735FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09735FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09735FYB 100 µg
MO-AB-08518H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08518C 100 µg
MO-AB-16392W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16392W 100 µg
MO-AB-21771R Monoclonal Cattle (Bos taurus) WB, ELISA MO21771R 100 µg
MO-AB-29525H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29525C 100 µg
MO-AB-66361W Monoclonal Marmoset WB, ELISA MO66361W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO09735FYB
SpecificityThis antibody binds to Zebrafish tmem126a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a mitochondrial membrane protein of unknown function. Defects in this gene are a cause of optic atrophy type 7 (OPA7). Two transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tmem126a Antibody is a mouse antibody against tmem126a. It can be used for tmem126a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 126A; tmem126
UniProt IDQ6PBL7
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MTMRDASQGLTSSRMRIIEMLNKKFEKLPESDRKMLSRGPLYLAANAGIAGMVANSFYRRVLHVTQGLFTSSLPMAVLPFVTTAALYTATVTTPLLSGDLNCPTCALIRGALVGVVGGGIYPILLALPVNAGLAARYNSAPMPEKGNIIRFWTNLSKPVVKKMSFVLVLQCVIGTFLSSRHFEIYLKMLRMPDSDSEQLNG.
For Research Use Only | Not For Clinical Use.
Online Inquiry