Mouse Anti-tmem141 Antibody (CBMOAB-09755FYB)


Cat: CBMOAB-09755FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09755FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09755FYB 100 µg
MO-AB-21782R Monoclonal Cattle (Bos taurus) WB, ELISA MO21782R 100 µg
MO-AB-22020W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22020W 100 µg
MO-AB-29537H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29537C 100 µg
MO-AB-66389W Monoclonal Marmoset WB, ELISA MO66389W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO09755FYB
SpecificityThis antibody binds to Zebrafish tmem141.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem141 Antibody is a mouse antibody against tmem141. It can be used for tmem141 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 141; tmem14
UniProt IDQ0D285
Protein RefseqThe length of the protein is 124 amino acids long.
The sequence is show below: MVNIGLSKVDDAIVAKHPGLQQYVACQSYAFMKGTASFILGTVGIFFGQRALQKIIKYPLQWNLFVSIVSSSVFSYSVTRWETMKCSDVWLFLETGNIPDRNSDKEEPETSADSTTTQHEDVLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry