AibGenesis™ Mouse Anti-TMEM17 Antibody (CBMOAB-60489FYA)


Cat: CBMOAB-60489FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60489FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO60489FYA 100 µg
MO-AB-16307W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16307W 100 µg
MO-AB-21805R Monoclonal Cattle (Bos taurus) WB, ELISA MO21805R 100 µg
MO-AB-29550H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29550C 100 µg
MO-AB-66417W Monoclonal Marmoset WB, ELISA MO66417W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO60489FYA
SpecificityThis antibody binds to Rhesus TMEM17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM17 Antibody is a mouse antibody against TMEM17. It can be used for TMEM17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM17
UniProt IDF7GXR8
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: ENEMVSSLALQMSLYFNTYYFPLWWVSSIMMLHMKYSILPDYYKFIVITVIILITLIEAIRLYLGYMGNLQEKVPELAGFWLLSLLLQLPLILFLLFNEGLTNLPLEKAIHIIFTLFLAFQVVAAFLTLRKMVNQLAVRFHLQDFDRLSANRGDMRRMRSCIEEI.
For Research Use Only | Not For Clinical Use.
Online Inquiry