AibGenesis™ Mouse Anti-tmem174 Antibody (CBMOAB-09800FYB)


Cat: CBMOAB-09800FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09800FYB Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO09800FYB 100 µg
MO-AB-29553H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29553C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO09800FYB
SpecificityThis antibody binds to Zebrafish tmem174.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem174 Antibody is a mouse antibody against tmem174. It can be used for tmem174 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem174; TMEM174 Gene(Protein Coding) Transmembrane Protein 174
UniProt IDA5PN43
Protein RefseqThe length of the protein is 520 amino acids long.
The sequence is show below: TNSSSNQSPSDVPVNIVSLVPSEALSSSDSQVSDGDKAGATLLFSGVFLGMVGMTFTAMGWAKNNGSNGYEWTQLLGPILLSVGGTFVLISICKFRMLSCLSCKQIEEEITPEVDTLPPLSGPSFVFTRLSQPITFHRGTVVQYIPPPYASVEPDHGLGNVNGLHSSHQPLAVTVSGPPQYYSVFPMDNAGFISGEHNNPTVQRGNRMPSLRNDQGNASVSDEEGKAGAADSASSPPAYEELFATSC.
For Research Use Only | Not For Clinical Use.
Online Inquiry