Mouse Anti-TMEM217 Antibody (MO-AB-21839R)


Cat: MO-AB-21839R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-21839R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO21839R 100 µg
MO-AB-29576H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29576C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO21839R
SpecificityThis antibody binds to Cattle TMEM217.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against TMEM217. It can be used for TMEM217 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 217; TMEM217
UniProt IDQ32LD5
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MKQQHWCGMTAKMGSLLSGVFTITAVDLYLIFEQKYLRRNNCTEQMSQIKNTSILIKVFIICWSLTIVFLLSFITILVSCLLLYSVYAHMHRGLLIYIVWIFFYETVNIVVQCLTNDNSSAAEVRVMRWFGLVSRICMHSFWMFFVITYAYMIYKNKSQGNIISYNRRISTSNGDFLPRKSKIINFSRRYSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry