AibGenesis™ Mouse Anti-tmem238 Antibody (CBMOAB-09916FYB)


Cat: CBMOAB-09916FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09916FYB Monoclonal Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO09916FYB 100 µg
CBMOAB-60552FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60552FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO09916FYB
SpecificityThis antibody binds to Zebrafish tmem238.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem238 Antibody is a mouse antibody against tmem238. It can be used for tmem238 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:ch211-232m10.4; tmem238; si:ch211-232m10.
UniProt IDQ1LUD4
Protein RefseqThe length of the protein is 105 amino acids long.
The sequence is show below: MVCSGVRHCKIALGFAVIFDIFGFTALFLGLFVPLELKGRDFGDLLVYTGALLVLMSLGGWVMWYSGNIEGMAAQKDLGGIGNAVDRLARNLSRKIYTHHVNKGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry