Mouse Anti-TMEM243 Antibody (MO-AB-15723W)


Cat: MO-AB-15723W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-15723W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO15723W 100 µg
MO-AB-21852R Monoclonal Cattle (Bos taurus) WB, ELISA MO21852R 100 µg
MO-AB-29591H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29591C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO15723W
SpecificityThis antibody binds to Chimpanzee TMEM243.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee TMEM243 Antibody is a mouse antibody against TMEM243. It can be used for TMEM243 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesChromosome 7 open reading frame 23; C7H7orf23; C7orf23
UniProt IDH2QUV5
Protein RefseqThe length of the protein is 118 amino acids long.
The sequence is show below: MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry