Mouse Anti-tmem256 Antibody (CBMOAB-09932FYB)


Cat: CBMOAB-09932FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09932FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO09932FYB 100 µg
MO-AB-12178W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12178W 100 µg
MO-AB-21860R Monoclonal Cattle (Bos taurus) WB, ELISA MO21860R 100 µg
MO-AB-29599H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29599C 100 µg
MO-AB-66499W Monoclonal Marmoset WB, ELISA MO66499W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO09932FYB
SpecificityThis antibody binds to Zebrafish tmem256.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem256 Antibody is a mouse antibody against tmem256. It can be used for tmem256 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTransmembrane protein 256; tmem25
UniProt IDQ568J8
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: MNAASLVQRVAGISGALAVAAGAYGAHGFRRSEASDYQRELFDTANKYHFYHSLALLGAARCRKPALAGVILLTGMGCFCGPLYHQPLTNDPSFSKLAPIGGSLLIVGWAAMAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry