AibGenesis™ Mouse Anti-tmem258 Antibody (CBMOAB-09933FYB)
Cat: CBMOAB-09933FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-09933FYB | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset | WB, ELISA | MO09933FYB | 100 µg | ||
| MO-AB-16239W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO16239W | 100 µg | ||
| MO-AB-21861R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21861R | 100 µg | ||
| MO-AB-66500W | Monoclonal | Marmoset | WB, ELISA | MO66500W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset |
| Clone | MO09933FYB |
| Specificity | This antibody binds to Zebrafish tmem258. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Zebrafish tmem258 Antibody is a mouse antibody against tmem258. It can be used for tmem258 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Transmembrane protein 258; tmem25 |
| UniProt ID | Q6PBS6 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFKAWFFVYEVTSTKYTRDVYKELLIALVASLFMGFGVHFLLLWVGIFV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry