AibGenesis™ Mouse Anti-TMEM30B Antibody (CBMOAB-60571FYA)


Cat: CBMOAB-60571FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60571FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis) WB, ELISA MO60571FYA 100 µg
MO-AB-08545H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08545C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis)
CloneMO60571FYA
SpecificityThis antibody binds to Rhesus TMEM30B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Golgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMEM30B Antibody is a mouse antibody against TMEM30B. It can be used for TMEM30B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMEM30B
UniProt IDH9H373
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGDSGTSNCSVCAEAGQGRAPPPPCSCAWSFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDEQLSGLPSALRHPVNECAPYQLSAAGLPIAPCGAIANSLFNDSFSLWHQRLPGGLYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAFQGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIAYLVVGSLCILTG.
For Research Use Only | Not For Clinical Use.
Online Inquiry