Mouse Anti-tmem44 Antibody (CBMOAB-09972FYB)


Cat: CBMOAB-09972FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09972FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta) WB, ELISA MO09972FYB 100 µg
CBMOAB-60595FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60595FYA 100 µg
MO-AB-17578W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17578W 100 µg
MO-AB-21881R Monoclonal Cattle (Bos taurus) WB, ELISA MO21881R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rhesus (Macaca mulatta)
CloneMO09972FYB
SpecificityThis antibody binds to Zebrafish tmem44.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem44 Antibody is a mouse antibody against tmem44. It can be used for tmem44 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:153362; tmem44; zgc:15336
UniProt IDQ0P465
Protein RefseqThe length of the protein is 343 amino acids long.
The sequence is show below: MAIMDVVNFLSISFSMYLWFKSRTGRKMRMISRRRRQNFLAVCLLFIMAGSVYLGLPVRSIPVRASPTMRRLFGMFLNDHTENLGYVLGLLAFAISWTSKFPFILKANRGEQGSAVLVSSRLLSSVAGALYGSAILLYDTQLKSVIKTMPWILSAICGSILDLSIVVLVCYRSSHKRPSVRSLDSDTESLLGEPSVTGQLCNNNECCRKKHHLSTARGISPKGTDMGLYMDVNIQPMRKVCLKEVTISRDGSSESLPLKRTVRVVRVDEHCSCGSSTDSSSLDSELEWDFGETKSQWTPVEEAPEDLQKVMPLQEWSVGSSGRLGSHVCFCNRAQLAEKLASK.
For Research Use Only | Not For Clinical Use.
Online Inquiry