AibGenesis™ Mouse Anti-tmem64 Antibody (CBMOAB-10011FYB)


Cat: CBMOAB-10011FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10011FYB Monoclonal Zebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO10011FYB 100 µg
CBMOAB-61394FYC Monoclonal Zebrafish (Danio rerio) WB, ELISA MO61394FYC 100 µg
MO-AB-06597W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06597W 100 µg
MO-AB-66541W Monoclonal Marmoset WB, ELISA MO66541W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rhesus (Macaca mulatta)
CloneMO10011FYB
SpecificityThis antibody binds to Zebrafish tmem64.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem64 Antibody is a mouse antibody against tmem64. It can be used for tmem64 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem64; si:dkeyp-34f6.5; TMEM64 Gene(Protein Coding) Transmembrane Protein 64
UniProt IDQ1LU94
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MWSSGPVQGVLKALKHAAGKGHIQLSRWLQRTPDSLDCDKIDILICNVFDERANGGKTDADPAGLTEPASSFTPEFRHPCCITTCCFKSALLACVLTAVCFSSVALVRQYLKDVLLWVESLDSLVGAMLFIVGLITVSFPCGWGYIVLNVAAGYLYGFVLGMGLVMVGVLIGTFIAHVVCKRLLTNWVLSKIGSSEQLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSVSITDVSLPNYLVASSVGLLPTQLLNSYLGTTLRTMEDVIAEQSISGYFVFSLQIFISIGLMFYVVHRAQVELNAAIAACQMEMKTSYMNGSAANHGGSTYCSKRTAATGGGINVV.
For Research Use Only | Not For Clinical Use.
Online Inquiry