AibGenesis™ Mouse Anti-tmem74b Antibody (CBMOAB-10026FYB)


Cat: CBMOAB-10026FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-10026FYB Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO10026FYB 100 µg
MO-AB-06606W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06606W 100 µg
MO-AB-08559H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08559C 100 µg
MO-AB-29624H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29624C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO10026FYB
SpecificityThis antibody binds to Zebrafish tmem74b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tmem74b Antibody is a mouse antibody against tmem74b. It can be used for tmem74b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestmem74b; TMEM74B Gene(Protein Coding) Transmembrane Protein 74B
UniProt IDE7F9B0
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MESLNAVELRELGERPQASSGPRPSTGIENASFEDEDPGSRIRVTSRASGPSFTSIDSQSNPLPIQREVPSPRSEDEPELEYNDHSVDYGFIFALVFLVSGIILVVIAYTIPREAKVNPDQVTARQMEKLEMYYAQLGSHLDKCIIAGLGLLTLGGMLLSVLLMVSICKGELYRRRTFARRPMKSYGSINMRMRQLAEGDGRDTLVECEPNTTADAANGNQVPAGTLNT.
For Research Use Only | Not For Clinical Use.
Online Inquiry